<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ABB07-96 ABB07-96 Cameroon 1996 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, I72V, L74I, L101I, T112V, T124A, G134N, K136T, G163E, V201I, T206S, L234I, R269RK  
>ABB07-96| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSATVKAACWWANITQEFGIPYNPQSQGVVESMNKELKKIIEQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIKDYGKQMAGDDCVASRQDED

References
Author Title Citation
Eshleman, SH Analysis of pol integrase sequences in diverse HIV type 1 strains using a prototype genotyping assay. ARHR, 2009