<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5168 CA12735 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA
2 Unknown 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M L10F L38LF, K55N, L63P, I64V, A71V, V77I, I93L  
>CA12735| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTILEEMNFPGRWKPKIIGGIGGFINVRQYD
QIPVEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y       K43KE, A98S, V118I, I135V, S162C, T200A, Q207E, V245E, P247PA, S251I, I293V  
>CA12464| codons 1-293
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELAEKDIWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVV

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004