<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1549 CA12713 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 187
2 3TC+AZT 67
3 3TC+D4T+IDV 39
4 DDC+DLV+NFV+SQV 22
5 3TC+D4T+NFV+SQV 63
6 APV+D4T+EFV 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, L33I, K43T, G73S L10I, I15V, K20R, M36I, Q61N, L63P, A71V  
>CA12713| codons 1-99
PQITLWQRPIVTIKVGGQLREALIDTGADDTVIEEINLPGRWTPKLIGGIGGFVKVRQYD
NIPIEICGHKVISTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L210W, T215Y K219R K103N   K43E, E44A, A98S, V111I, V118I, I135T, I142V, E203K, H208Y, R211K, F214L, K223Q, L228R, I257L, A272P, I274IV, K277R, T286A, I293V I270IL
>CA12427| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDIGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIKELRQYLWKWGLYTPDRKHQQEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDLQKLVGKLNWASQLYPGVKVRQLCKLLRGAKALTEVVPLTEEAE
LE

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005