<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KC63 KC63PROT Cambodia 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, E35D, M36I, R41K, I62V, L63P, H69K, V82VI, L89M, F99FL  
>KC63PROT| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNL

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39K, K43E, S68G, K122E, D123S, I135T, T165I, K173R, Q174K, D177E, I178M, Q207A, R211S  
>KC63RT| codons 36-239
EICKEMEEEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMIKILEPFRRKNPEMVIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFT
TPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Nouhin, J Low prevalence of drug resistance transmitted virus in HIV Type 1-infected ARV-naive patients in Cambodia. ARHR, 2009