<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KC27 KC27PROT Cambodia 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, G51GA, H69K, V82I, L89M, I93L  
>KC27PROT| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIAGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D T39K, K43E, K122E, D123N, K173I, Q174K, D177E, Q207A, R211S, K238R  
>KC27RT| codons 36-239
EICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRIKNPEIDIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFT
TPDKKHQKEPPFLWMGYELHPDRW

References
Author Title Citation
Nouhin, J Low prevalence of drug resistance transmitted virus in HIV Type 1-infected ARV-naive patients in Cambodia. ARHR, 2009