<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5121 CA12692 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 144
2 3TC+AZT+DDC+SQV 13
3 AZT+DDC+IDV 43
4 3TC+D4T 133

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, K20R, M36I, R41K, I62V, I64V, K70KR Q58QH
>CA12692| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRHYD
QVLVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210LW, T215Y       V60I, K122KE, I135T, I142IT, K166R, E169ED, T200E, R211RK, V245KM, A272P, K275Q, V276T, K277R, A288AS, I293V  
>CA12411| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTRILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHREKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIQTRQLCKLLRGTKSLTEVVPLTEEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001