<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
7 PBMC7 China 2005 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, E35D, M36I, R41K, H69K, L89M, I93L  
>PBMC7| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39KN, K43E, S68G, K122E, D123N, K166R, K173I, Q174K, N175H, D177E, I178M, T200V, Q207A, R211S  
>plasma7| codons 1-242
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICNEMEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKHPEMVI
YQYMDDLYVGSDLEIGQHRVKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Tu, YQ Human immunodeficiency virus-1 genotypic drug resistance among volunteer blood donors in Yunnan, China. Transfusion, 2009