<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1836 CA12632 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ D4T+ DDC+ DDI NA
2 IDV+ NFV+ RTV NA
3 D4T+ DLV+ NFV NA
4 3TC+ D4T+ RTV+ SQV 24
5 3TC+ D4T+ NFV+ SQV 7
6 3TC+ ABC+ NFV+ SQV 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, K20R, E35D, M36I, I62V, L63P, A71V, T74S, I93IL  
>CA12632| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGSVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V K219KR     V35I, D123E, D177E, T200I, I202V, R211K, A272P, I293V  
>CA12349| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKVEELRQHLLKWGFTTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LE

References
Author Title Citation
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005