<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1130 CA12611 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 D4T 32
3 3TC+ AZT 56
4 SQV+ RTV+ D4T+ 3TC 136

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IL, I84V, L90M L33LF, G73T L10I, T12TS, L63P, A71V, V77I, I93L  
>CA12611| codons 1-99
PQITLWQRPIVSIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFLKVRQYD
QIPIEICGHKVITTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     K43E, T69N, K122E, D123E, Q174K, D177E, I178M, Q207E, R211K, F214L, A272P, V292VI  
>CA12328| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEEEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003