<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IR12 IR12 Iran 2008 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19Q, K20R, E35D, M36I, R41K, R57K, H69K, L89M  
>IR12| codons 1-99
PQITLWQRPLVTVKIGGQQREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, D121HY, K122E, I135R, T139TA, Q174H, D177E, V179I, T200V, Q207T, R211K L34LS, D110N
>IR12| codons 12-244
LKPGMDGPKVKQWPLTEEKIKASTEICTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKW
RKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLNVGDAYFSVPLYEDFRKYTAFT
IPSRNNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPEIIIYQYMDDLYVGS
DLEIGQHRVKIEELRTHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPI

References
Author Title Citation
Soheilli, ZS Presence of HIV-1 CRF35_AD in Iran. ARHR, 2009