<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IR09 IR09 Iran 2008 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19Q, K20R, E35D, M36I, R41K, R57K, C67Y, H69K, L89M  
>IR09| codons 1-99
PQITLWQRPLVTVKIGGQQREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEIYGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V8I, V35T, V60I, D121Y, K122E, D123E, I135R, Q174H, D177E, V179I, T200I, Q207A, H208HL, R211K, D250E  
>IR09| codons 1-255
PISPIDTIPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPEIII
YQYMDDLYVGSDLEIGQHRIKIEELRALLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVN

References
Author Title Citation
Soheilli, ZS Presence of HIV-1 CRF35_AD in Iran. ARHR, 2009