<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA635 CA12602 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 21
2 AZT+DDC 35
3 3TC+AZT 31
4 3TC+AZT+D4T 13
5 3TC+AZT+IDV 4
6 D4T+DDI+SQV 39
7 D4T+DDI+RTV+SQV 13
8 3TC+D4T+RTV+SQV 135

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S W6WC, L10I, K14GR, I15V, E34D, M36I, I62V, L63P, A71I, P79A, I93L  
>CA12602| codons 1-99
PQITLCQRPIVTIGVGGQLKEALLDTGADDTVLDEINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKIISTVLVGATPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151M, M184V, T215F K219Q     V118I, K122E, D123E, I135T, V179VI, Q207EK, F214L, T286A, E297K  
>CA12321| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LEL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005