<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5046 CA12601 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 22
2 None 100
3 3TC+AZT 9
4 3TC+AZT+IDV 39
5 3TC+D4T+SQV 35
6 AZT+RTV+SQV 26
7 AZT+DDI+RTV+SQV 30
8 ABC+D4T+EFV 53

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S T12A, I13V, K14R, I62V, L63P, A71V, I72M, V77I  
>CA12601| codons 1-99
PQITLWQRPLVAVRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVMSTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R K219HQ K103N, Y181YC   K20R, V60I, I135T, D177E, I178M, E203X, H221Y, L228LR, V245T, I293V  
>CA12320| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYMDDLYVGSDLEIGQHRTKIXELRQHLLRWGFTTPDHKYQKEPPFRWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005