<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
92RW008 92RW008 Rwanda 1992 HIV1 A PBMC Cons

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, K14R, E35D, R41K, K45R, R57K, H69K, L89M  
>92RW008| codons 5-99
LWQRPLVTVRIGGQLKEALLDTGADDTVFEDMNLPGKWKPRMIGGIGGFIKVKQYDQILI
EICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39S, K49R, V60I, D113X, K122E, D123S, I135T, I142T, K166R, K173S, Q174K, V179I, T200A, Q207A, R211S, E248K, A272P, T286A, E291D, V292I, I293V, P294T S251P
>92RW008| codons 1-297
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICSEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGXAYFSVPL
DESFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTRILEPFRSKNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPKKDPWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTE

References
Author Title Citation
Cornelissen, M Pol diversity of five HIV-1 subtypes: Evidence for naturally occurring mutations that contribute to drug resistance, limited recombination patterns, and common ancestry for subtypes B and D. J Virol, 1997