<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ABB123-98 ABB123-98 Cameroon 1998 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6S, E10D, E13D, K34R, I72V, T112V, I113V, T124A, V201I, I208IL, K211R, L234I, A265V  
>ABB123-98| codons 1-288
FLDGISKAQDEHDKYHSNWRAMASDFNLPPVVAREIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDLQTRELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Brennan, CA The prevalence of diverse HIV-1 strains was stable in Cameroonian blood donors from 1996 to 2004. JAIDS, 2008