<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ABB32-96 ABB32-96 Cameroon 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, M50I, I72V, T124A, M154L, E157G, G193D, S195T, K211R, I268L, D270N  
>ABB32-96| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESLNKGLKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGDYTAGERIVDIIATDIQTRELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKILRNYGKQMAGDDCVASRQDED

References
Author Title Citation
Brennan, CA The prevalence of diverse HIV-1 strains was stable in Cameroonian blood donors from 1996 to 2004. JAIDS, 2008