<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ABB21-96 ABB21-96 Cameroon 1996 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  T97A D6S, E10ED, E13D, V32I, I72V, L101I, K103N, T112V, I113V, T125A, V126M, K160R, V201I, L234I, D279G R284G
>ABB21-96| codons 1-288
FLDGISKAQDEHDKYHSNWRAMASDFNLPPVIAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQEAAYFILNLAGRWPVKVVHTDNGSN
FTSTAMKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKRIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDGCVASGQDED

References
Author Title Citation
Brennan, CA The prevalence of diverse HIV-1 strains was stable in Cameroonian blood donors from 1996 to 2004. JAIDS, 2008