<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  T97A S17N, K46KQ, L101I, T112I, T125V, K136Q, G163A, V201I, T218S, Y227F, L234S, S255N, D256E S283G
>A1699| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLQGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQEAAYFILKLAGRWPVKIIHTDNGSN
FTSTVVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIAQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQISKIQNFRVYFRDSRDPSWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Brennan, CA The prevalence of diverse HIV-1 strains was stable in Cameroonian blood donors from 1996 to 2004. JAIDS, 2008