<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4990 CA12578 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+DDI 13
3 3TC+D4T+SQV 39
4 3TC+AZT+IDV 117
5 ABC+ADV+D4T+NVP 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, L90M   L10I, E35D, N37D, D60E, I62V, L63C, A71T, V77I, I93L, C95F  
>CA12578| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFMKVRQYE
QVCIEICGHKTIGTVLIGPTPVNIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M A62V, V75I, F77L, F116Y Y181C   S68G, K101Q, K122E, S134SR, I142V, S162C, R211K, F214L, H221Y, I293V, E297T T131TA
>CA12256| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKRKDGTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYYSVPL
DEDFRKYTAFAIPRINNETPGVRYQYNVLPMGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTTEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009