<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
851-30 851-30 Cameroon 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  E138D V31I, I72V, L101I, T124N, T206TS, Y227F, D256E, A265V S283G
>851-30| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSNTVKAACWWAGIKQDFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDIQTKELQKQITKIQNFRVYFRDSRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKVKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Brennan, CA The prevalence of diverse HIV-1 strains was stable in Cameroonian blood donors from 1996 to 2004. JAIDS, 2008