Isolate Data
Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
CA5023 | CA12562 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
Order | Regimen | Weeks |
1 | 3TC+AZT | 18 |
2 | Unknown | 26 |
3 | 3TC+D4T+NFV | 69 |
Protease Sequence
PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
V32I, M46I, I54V, V82A | L10I, N37S, I62V, L63P, A71L, I72T |
>CA12562| codons 1-99 PQITLWQRPIVTIKIGGQLKEALLDTGADDTILEEMSLPGRWKPKIIGGIGGFVKVRQYD QVPIEICGHKLTGTVLVGPTPANIIGRNLLTQIGCTLNF |
References
Author | Title | Citation |
Gonzales, MJ | HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. | J Infect Dis, 2001 |
Rhee, SY | HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. | J Infect Dis, 2005 |