Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA5023 | CA12562 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | 3TC+AZT | 18 |
| 2 | Unknown | 26 |
| 3 | 3TC+D4T+NFV | 69 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| V32I, M46I, I54V, V82A | L10I, N37S, I62V, L63P, A71L, I72T |
| >CA12562| codons 1-99 PQITLWQRPIVTIKIGGQLKEALLDTGADDTILEEMSLPGRWKPKIIGGIGGFVKVRQYD QVPIEICGHKLTGTVLVGPTPANIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Gonzales, MJ | HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. | J Infect Dis, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |