<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4832-9 4832-9 Cameroon 2004 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, V31I, V32I, L45I, I72IV, L74I, I89IV, T112V, T124TA, T125A, V126M, G134D, G163E, G193GE, V201I, L234I, N254K  
>4832-9| codons 1-278
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPIIAKEIVASCDKCQIKGEAMHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVVPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSAAMKAACWWADIKQEFGIPYNPQSQGVVESMNKELKKIIEQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGEYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDKSDIKVVPRRKAKIIRDYGKQMAGD

References
Author Title Citation
Brennan, CA The prevalence of diverse HIV-1 strains was stable in Cameroonian blood donors from 1996 to 2004. JAIDS, 2008