<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TMS311 TMS311 Tanzania 2005 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 NVP NA
2 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181YC, G190GA   V35T, T39M, V60I, D121Y, K122E, K173S, Q174K, D177E, I178L, V179I, Q207E, R211K, V245K, A272Q, K275Q, K277R, L282C, L283I, T286A, I293V, P294S, E297K, G335D, E344D, P345Q, F346Y, K347KR, R356K, G359S E29ED
>TMS311| codons 1-376
PISPIETVPVKLKPGMDGPKVKQWPLTEDKIKALTEICMEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPELII
CQYMDDLYVASDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYQGIQVRQLCKCIRGAKALTEVVSLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQDQYRNLKTGKYAKMRSA
HTNDVKQLTEAVQKIA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, R41K, D60E, I62V, I64V, I72V  
>TMS311| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QVLVEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Nyombi, BM Diversity of human immunodeficiency virus type 1 subtypes in Kagera and Kilimanjaro regions, Tanzania. ARHR, 2008