<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TMS211 TMS211 Tanzania 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP NA
2 None NA
3 3TC+D4T+NVP 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   G190A   P14A, V35T, T39E, S48T, D121H, K122E, K166R, K173L, Q174K, D177E, I178L, T200E, Q207E, R211K, V245M, D250E, A272P, K277R, T286A, E291D, V292I, I293V, Q334N, G335D, R356K, M357R, G359T, A376T, T377M  
>TMS211| codons 1-385
PISPIETVPVKLKAGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRLKNPELVI
YQYVDDLYVASDLEIGQHREKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNDQWTYQIYQEPFKNLKTGKYAKRRTA
HTNDVKQLTEAVQKITMESIVIWGK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16E, L19I, M36I, R41K, L63T, H69K, I93L  
>TMS211| codons 1-99
PQITLWQRPLVSIKVEGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Nyombi, BM Diversity of human immunodeficiency virus type 1 subtypes in Kagera and Kilimanjaro regions, Tanzania. ARHR, 2008