<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4894 CA12535 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 35
2 D4T 65
3 3TC+AZT 13
4 3TC+AZT+IDV 65
5 DDI+NFV+NVP 22
6 3TC+D4T+IDV 61
7 3TC+D4T+EFV+IDV 26
8 3TC+D4T+EFV+IDV+RTV 6

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73T W6WC, L10I, T12E, R41K, K55R, I62V, L63P, I72X, V77I  
>CA12535| codons 1-99
PQITLCQRPIVEIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIRVRQYD
QVPIEICGHKAXTTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184I, T215F K219Q Y181C, Y188L, G190A   T69N, V90I, K102E, K122E, D123Q, I135T, S162Y, D177E, I178M, R211K, D218DG, D237DE, V245K, K277R, Q278E  
>CA12000| codons 1-280
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKEKKSVTVLDVGDAYFSVPL
DEQFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPEMVI
CQYIDDLLVASDLEIGQHRTKIEELRQHLLKWGFFTPGQKHQKEPPFLWMGYELHPEKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRELC

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005