<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5212 CA12519 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 239
2 3TC+AZT 109
3 3TC+AZT+IDV 22
4 3TC+D4T+IDV 35
5 3TC+D4T+NFV 106

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, T69D, K70R, M184V, T215FS K219Q   A98AG K20R, T39AE, V60I, K102X, V118I, D123E, S134SR, I135T, I142L, K166R, I178IM, I202V, R211RK, F214L, L228H, A272P N136NS, E138EV
>CA12519| codons 1-276
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKXKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPRTSNVTPGLRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGLFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88ND K20KI, D60E, Q61E, I62V, L63P, V77VI, I93L, C95CS  
>CA12797| codons 7-99
QRPFVTIKIGGQLIEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYEEVPIEI
CGHKAIGTVLIGPTPVNIIGRDLLTQLGSTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005