<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1149 CA12512 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDI NA
3 3TC+AZT+SQV 74
4 3TC+D4T+NFV 39
5 DDI+NVP+IDV NA
6 D4T+DDI+NVP+IDV 59

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N, Y181YC K238T M16MV, I31IL, K122E, I135IM, S162C, L228LR, V245E, K277R, Q278H, T286A, E291D, E297K  
>CA12512| codons 1-302
PISPIETVPVKLKPGVDGPKVKQWPLTEEKLKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFRWMGYELHPDTWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLRGAKALTDVIPLTKEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73A L63P, I64IV, T74S, V77I  
>CA12790| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIASVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005