<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
16 GR16 Greece 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S K43T, L89V I13V, K20I, E35DG, M36I, N37D, R41K, I62IV, H69K, A71T  
>GR16| codons 4-99
TLWQRPLVTVKIGGQLIEALLDTGADDTVLEGIDLPGKWTPKIIGGIGGFIKVRQYDQVL
IEICGKKTIGTVLVGPTPVNIIGRSVLTQIGCTLNF

References
Author Title Citation
Papa, A Genetic variation of the protease and reverse transcriptase genes in HIV-1 CRF04_cpx strains. ARHR, 2002