<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
64 GR64 Greece 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|DDI|RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L33F I13V, E35D, M36I, N37D, R41K, H69KR, L89M  
>GR64| codons 4-99
TLWQRPLVTVKIGGQLKEALLDTGADDTVFEDIDLPGKWKPKMIGGIGGFVKVRQYDQIL
IEICGRKAIGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215TI, K219Q     E40D, V60I, K64H, T69N, K122P, I135L, I142V, S162H, K166R, K173A, Q174R, D177E, I178V, T200A, Q207G, R211K, L228LH, V245Q  
>GR64| codons 38-246
CTDMEKEGKISKIGPENPYNTPIFAIHKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSLNNETPGVRYQYNVLPQGWKGSP
AIFQHSMTRILEPFRARNPEVVIYQYVDDLYVGSDLEIGQHRAKIEELRGHLLKWGFITP
DQKHQKEPPFHWMGYELHPDKWTVQPIQL

References
Author Title Citation
Papa, A Genetic variation of the protease and reverse transcriptase genes in HIV-1 CRF04_cpx strains. ARHR, 2002