<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
321 321 Thailand 2001 HIV1 CRF01_AE Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, K20I, E35D, M36I, R41K, I64V, H69K, L89M  
>321| 321-9 | codons 1-99 | clone 321-9
PQITPWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGKKAIGTVLVGPTPVNIIGRNMMTQIGCTLNF
>321| 321-3 | codons 1-99 | clone 321-3
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGKKAIGTVLVGPTPVNIIGRNMMPQIGCTLNF
>321| 321-2 | codons 1-99 | clone 321-2
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGKKAIGTVLVGPTPVNIIGRNMMTQIGCTLNF
>321| 321-1 | codons 1-99 | clone 321-1
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGKKAIGTVLVGPTPVNIIGRNMMTQIGCTLNF
>321| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGKKAIGTVLVGPTPVNIIGRNMMTQIGCTLNF
>321| 321-10 | codons 1-99 | clone 321-10
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIRGIGGFIKVRQYD
QILVEICGKKAIGTVLVGPTPVNIIGRNMMTQIGCTLNF

References
Author Title Citation
Nukoolkarn, S Sequence variability of the HIV type 1 protease gene in Thai patients experienced with antiretroviral therapy. ARHR, 2004