<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
267 267 Thailand 2001 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 IDV+RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I   L63T, I72T, L89M  
>267| 267-8 | codons 1-99 | clone 267-8
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYD
QITIEICGHKATGTVLVGPTPANIIGRNMLTQIGCTLNF
>267| 267-7 | codons 1-99 | clone 267-7
PQITLRQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QITIEICGHKATGTVVVGPTPVNIIGRNMLTQIGCTLNF
>267| 267-5 | codons 1-99 | clone 267-5
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QITIEICGHKATGTVVVGPTPVNIIGRNMLTQIGCTLNF
>267| 267-4 | codons 1-99 | clone 267-4
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QITIEICGHKATGTVLVGPTPVNIIGRNMLTQIGCTLNF
>267| 267-3 | codons 1-99 | clone 267-3
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QITIEICGHEATGTVVVGPTPVNIIGRNMLTQIGCTLNF
>267| 267-2 | codons 1-99 | clone 267-2
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYD
QITIEICGHKATGTVLVGPTPANIIGRNMLTQIGCTLNF
>267| 267-1 | codons 1-99 | clone 267-1
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGNWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGSVLVGPTPVNIIGRNMMTQIGCTLNF
>267| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QITIEICGHKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Nukoolkarn, S Sequence variability of the HIV type 1 protease gene in Thai patients experienced with antiretroviral therapy. ARHR, 2004