<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
220 220 Thailand 2001 HIV1 CRF01_AE Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV+RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A G48I, F53L, L89V L10I, I13V, K20I, E35D, M36I, N37D, R41K, L63P, H69K, A71V  
>220| 220-5 | codons 1-99 | clone 220-5
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEDIDLPGKWKPKMIIGIGGLVKVRQYD
QIPIEICGKKVIGTVLVGPTPANIIGRNVLTQIGCTLNF
>220| 220-3 | codons 1-99 | clone 220-3
PQITLWQRPIVTAKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIMGIGGLVKVRQYD
QILIEFCGKKAIGTVLVGPTPANIIGRNILTQIGCTLNF
>220| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEDIDLPGKWKPKMIIGIGGLVKVRQYD
QIPIEICGKKVIGTVLVGPTPANIIGRNVLTQIGCTLNF
>220| 220-2 | codons 1-99 | clone 220-2
PQITLWQRPIVTAKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIMGIGGLVKVRQYD
QILIEFCGKKAIGTVLVGPTPANIIGRNILTQIGCTLNF
>220| 220-1 | codons 1-99 | clone 220-1
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEDIDLPGKWKPKMIIGIGGLVKVRQYD
QIPIEICGKKVIGTVLVGPTPANIIGRNVLTQIGCTLNF

References
Author Title Citation
Nukoolkarn, S Sequence variability of the HIV type 1 protease gene in Thai patients experienced with antiretroviral therapy. ARHR, 2004