<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt049 Pt049 Central African Republic 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA
2 3TC+AZT+IDV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, G190A   D121H, K122E, D123S, I142T, K173A, Q174K, D177E, I202V, Q207A, R211S  
>Pt049| codons 41-240
MEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
EKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRAKNPEIVIYQYVDDLYVASDLEIGQHRTKVEELRAHLLSWGFTTPDKK
HQKEPPFLWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16A, K20I, M36L, N37D, D60E, Q61E, I62V, L63T, C67E, H69R, I72K, T74S, V77I, L89M  
>Pt049| codons 1-99
PQITLWQRPLVTVKIAGQLIEALLDTGADDTVLEELDLPGRWKPKMIGGIGGFIKVRQYE
EVTIEIEGRKAKGSVLIGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Gody, JC High prevalence of antiretroviral drug resistance mutations in HIV-1 non-B subtype strains from African children receiving antiretroviral therapy regimen according to the 2006 revised WHO recommendations. JAIDS, 2008