<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt045 Pt045 Central African Republic 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, L19F, E35D, M36I, R41K, R57K, H69K, L89M  
>Pt045| codons 1-99
PQITLWQRPIVTVKIGGQFKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184V V75I Y181C   V8I, K11T, V35T, T39R, K43E, S68G, K101R, D121H, K122E, D123S, I132L, F171Y, K173A, Q174K, I202V, Q207A, R211S, H221Y, V245E, K275KR, T286A, A288T, E291D, V292I, I293V, P294T, E312T, I326V  
>Pt045| codons 1-334
PISPIETIPVTLKPGMDGPKVKQWPLTEEKIKALTEICREMEEEGKISKIGPENPYNTPV
FAIKRKDGTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTLPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRAKNPDIVI
CQYVDDLYVGSDLEIGQHRTKVEELRAHLLSWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIRVKQLCKLLRGAKTLTDIVTLTEEAE
LELAENREILKTPVHGVYYDPSKDLVAEIQKQGQ

References
Author Title Citation
Gody, JC High prevalence of antiretroviral drug resistance mutations in HIV-1 non-B subtype strains from African children receiving antiretroviral therapy regimen according to the 2006 revised WHO recommendations. JAIDS, 2008