<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt041 Pt041 Central African Republic 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V   Y181C, G190A   K49R, V60I, D121H, K122E, I135T, K173A, Q174K, D177E, I178L, T200A, Q207A, R211S, K238R K101D
>Pt041| codons 41-240
LEKEGKISRIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
DKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRAKNPELVICQYVDDLYVASDLEIGQHRAKIEELRAHLLSWGFTTPDKK
HQKEPPFLWMGYELHPDRWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I13V, L19I, E35D, M36I, R41K, L63S, H69K, L89M  
>Pt041| codons 1-99
PQITLWQRPLVPVKIGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Gody, JC High prevalence of antiretroviral drug resistance mutations in HIV-1 non-B subtype strains from African children receiving antiretroviral therapy regimen according to the 2006 revised WHO recommendations. JAIDS, 2008