<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt030 Pt030 Central African Republic 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C A98G K20R, V35T, T39N, K49KR, V60I, K122E, I135T, T139R, I142V, K173T, D177E, T200A, Q207A, R211K, F214FL, V245M, A272P, T286A, E291D, V292I, I293V, E297A, E312D  
>Pt030| codons 1-320
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICNEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNERPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELRAHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKDPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, I15V, L19I, K20I, E35D, M36I, N37D, I62IV, I64IM, C67S, H69K, V82I, L89M  
>Pt030| codons 1-99
PQITLWQRPLVSVKVGGQIIEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QVLMEISGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Gody, JC High prevalence of antiretroviral drug resistance mutations in HIV-1 non-B subtype strains from African children receiving antiretroviral therapy regimen according to the 2006 revised WHO recommendations. JAIDS, 2008