<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR102 03ZA.DR102 South Africa 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+RTV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M A62AV, V75I, F77FL, F116Y     A33AV, V35T, T39E, S68SG, T69S, K122E, D123S, K173A, D177E, T200A, Q207E, R211K, V245Q, S251N, A272P, K275Q, K277R, T286A, E291D, V292I, I293V  
>03ZA.DR102| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKVLTEICEEMEKEGKISKIGPENPYNTPV
FVIKKKDGSKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDNWTVNDIQKLVGKLNWASQIYPGIQVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82L, L90M   I13IV, I15V, K20R, M36I, R41RK, L63LP, H69K, L89I  
>03ZA.DR102| codons 1-99
PQITLWQRPLVTVKVGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGKKAIGTVLVGPTPLNIIGRNIMTQIGCTLNF

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008