<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR100 03ZA.DR100 South Africa 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+RTV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E6A, M16L, V35T, T39E, S48T, K122E, K173A, Q174R, D177E, T200E, I202V, Q207A, R211K, P243T, V245Q, A272P, L279T, T286A, E291D, V292I, I293V, E297K, G333E, Q334H K30M
>03ZA.DR100| codons 1-335
PISPIATVPVKLKPGLDGPKVKQWPLTEEMIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRARNPEIVI
YQYVDDLYVGSDLEIGQHREKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQTCKLLRGAKALTDIVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEHG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A   G16GE, L19E, K20R, E35D, M36I, R41K, H69K, L89I, I93L I15E
>03ZA.DR100| codons 1-99
PQITLWQRPLVTIKEEGQEREALLDTGADDTVLEDINLPGKWKPKIIGGIGGFVKVRQYD
QILIEICGKKAIGTVLVGPTPANIIGRNILTQLGCTLNF

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008