<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR92 03ZA.DR92 South Africa 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+D4T+IDV NA
2 D4T+EFV+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M   T12S, I13IV, I15V, L19IT, K20R, M36I, L38LV, R41K, D60E, Q61E, I62IV, L63P, H69K, L89M, I93L  
>03ZA.DR92| codons 1-99
PQITLWQRPLVSVKVGGQTREALLDTGADDTVLEEINVPGKWKPKMIGGIGGFIKVRQYE
EVPIEICGKKAIGTVLVGPTPANIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R T215C, K219Q V106M, Y188YC, G190GA   P4S, V35T, T39E, V60I, K122E, I135V, S163C, K166R, K173V, D177E, Q197I, T200A, I202V, Q207E, R211K, L228H, V245Q, A272P, K277R, E291D, V292I, I293V, K311KR, V317A I244IR, I274IS
>03ZA.DR92| codons 1-333
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSCMTRILEPFRVQNPEIVI
YQYMDDLCVASDLEIGIHRAKVEELREHLLKWGFCTPDQKHQKEPPFHWMGYELHPDKWT
VQPRQLPEKDSWTVNDIQKLVGKLNWASQIYPGSKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILREPVHGAYYDPSKDLIAEIQKQG

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008