<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5197 CA12498 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y K219N Y181C, P236L   T39A, E44D, S68G, V118I, K166Q, I202IM, Q207N, R211K, L228H, V245E L234P, H235I
>CA12498| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTQILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKMEELRNHLWKWGFYTPDNKHQKEPPFHWMGYEPILDKWT
VQPIELPEKDSWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M   L10I, I13V, N37D, L38LF, Q61E, I62V, L63P, I64V, T74S, V77I, I93L  
>CA12776| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMDFPGRWKPKIIGGIGGFVKVRQYD
EVPVEICGHKAIGSVLIGPTPFNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005