<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR84 03ZA.DR84 South Africa 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y188L, G190A V179D V8I, V35K, T39E, S48E, V60I, K103R, I159V, K173T, Q174K, T200A, Q207E, R211K, V245Q, D250E, A272P, K277T, K281KR, T286A, V292I, I293V, E297K, L301F  
>03ZA.DR84| codons 1-333
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALKEICEEMEKEGKIEKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAVFQSSMTKILEPFRTKNPDIDI
YQYMDDLLVASDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVTQLCRLLRGAKALTEIVPLTKEAE
FELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12E, I15V, L19I, M36I, R41K, L63DV, I64M, H69K, I72V, L89M, I93L  
>03ZA.DR84| codons 1-99
PQITLWQRPLVEIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVMEICGKKAVGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008