<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR43 DR43 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NFV NA
2 DDI+ D4T NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19V, M36I, R41K, L63LP, H69K, L89M, I93L L76L*
>DR43| codons 1-99
PQITLWQRPLVSIKVGGQVKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTV*VGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M F116Y     K32E, V35T, E36A, T39AE, S48T, K122E, D123G, I135K, I142IV, S162C, K173A, Q174K, D177E, T200A, Q207E, R211K, F214FL, V245Q, A272P, I274V, K275Q, K277R, T286A, E291D, V292I, I293V  
>DR43| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIEALTAICAEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DEGFRKYTAFTIPSKNNETPGVRYQYNVLPMGWKGSPAIFQCSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGVQVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008