<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR26 02ZA.DR26 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R A62V, V75T     I2V, V35T, T39E, S48T, E53D, S68G, V118I, K122E, D123S, I135T, E138A, E169ED, K173AT, Q174K, I178M, T200A, Q207E, R211RK, F214L, K219G, V245VE, D250E, K263KN, A272P, K277R, L283I, T286A, E291D, V292I, I293V, V317A  
>02ZA.DR26| codons 1-333
PVSPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPDNPYNTPV
FVIKRKDGTKWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRTKNPDMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDGKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGNLNWASQIYPGIKVRQLCKLIRGAKALTDIVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19V, M36I, R41K, K45R, D60E, L63LP, H69K, L89M, I93L  
>02ZA.DR26| codons 9-99
PLVSIKVGGQVKEALLDTGADDTVLEEINLPGKWKPRMIGGIGGFIKVRQYEQIPIEICG
KKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008