<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR18 02ZA.DR18 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70KR   V106M V179D E6EK, K20KR, V35T, T39E, K66E, L100LV, K102Q, K103R, K122E, I135IM, I142IV, K173T, T200A, E204Q, Q207E, F214L, V245Q, A272P, T286V, V292I, I293V, G333E, Q334H S48IT, G51GW
>02ZA.DR18| codons 1-335
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEEMEKEGKITKIWPENPYNTPV
FAIKKENSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGVKQRKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSMNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPDIDI
YQYMDDLYVGSDLEIGQHRAKIEQLREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGVKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEHG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, E35D, M36I, R41K, H69K, T74S, L89M, I93L  
>02ZA.DR18| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008