<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR16 02ZA.DR16 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT+NFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215F     A98G V35T, T39E, E44D, S48T, E53D, V111I, V118VI, K122E, D123S, E138EA, K173A, Q174K, D177E, G196E, T200A, E203V, Q207E, H208Y, R211K, V245Q, E248D, A272P, K277R, T286A, E291D, V292I, I293V D121DG
>02ZA.DR16| codons 1-310
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKDGKITKIGPDNPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDIGDAYFSIPL
GESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIEQHRAKIVELREYLWKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREIL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, V32VA, N88D I15IL, G16E, L19I, E35D, M36IV, R41K, Y59YF, Q61E, I62IV, H69K, T74S, L89M, I93L, N98K  
>02ZA.DR16| codons 1-99
PQITLWQRPFVTIKLEGQIKEALLDTGADNTALEDVNLPGKWKPKMIGGIGGFIKVRQFD
EVLIEICGKKAIGSVLVGPTPVNIIGRDMLTQLGCTLKF

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008