<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5172 CA12469 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+NFV+NVP 9
2 D4T+DDI+NFV+NVP 65
3 None 18

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R D67G, K219Q Y181C   K20R, V35M, K64H, T69N, V118I, K122E, I135T, D177E, I178M, T200A, F214L, H221Y, T286A, I293V I132IR
>CA12469| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIHKKGSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTRPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTPDQKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, K14R, I15V, K20T, M36I, N37D, I62V, L63P, I64V  
>CA12751| codons 1-99
PQITLWQRPLVTVRVGGQLTEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005