<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1446 CA12465 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+DDI 8
3 3TC+D4T+IDV 22
4 NFV+NVP+SQV 35
5 None 24
6 3TC+AZT+IDV+RTV 13
7 3TC+AZT+IDV+SQV 32
8 ABC+D4T+EFV+RTV+SQV 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184MV, L210W, T215Y K219KN K103N, V106M   K20R, V35IM, E44D, R83K, K102KR, K122KE, E169D, T200A, H208Y, R211K, L228Q, I293V  
>CA12465| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKKTQDFWEVQLGIPHPAGLKRNKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQYLWKWGFYTPDNKHQKEPPFQWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V L24I, L33I, L89V L10I, I13V, E35D, M36I, N37D, R57K, L63P, A71V, I93L  
>CA12736| codons 1-99
PQITLWQRPIVTVKIGGQLKEALIDTGADDTVIEDIDLPGRWKPKIIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPTNVIGRNVLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005