<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2340 Gab2340RT Gabon 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, T107S, V118I, D121C, I142V, T165I, K173E, D177E, I178V, T200A, E204K, Q207E, F214L  
>Gab2340RT| codons 40-233
EMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKKKKSVSVLDVGDAYFSIPLCKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAI
FQSSMIKILEPFREQNPEVVIYQYMDDLYVGSDLEIGQHRAKIEKLREHLLRWGLTTPDK
KHQKEPPFLWMGYE

References
Author Title Citation
Caron, M Human immunodeficiency virus type 1 seroprevalence and antiretroviral drug resistance-associated mutations in miners in Gabon, central Africa. ARHR, 2008