<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
G29 G29-AFMC32 India 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  N348I     V35T, T39I, V60I, K122E, D123S, I135T, S162Y, K173L, Q174K, D177E, Q197K, T200A, Q207A, R211S, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, G335D, R356K, G359T, T377M, K390R, A400T  
>G29-AFMC32| codons 1-401
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICIEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRLKNPEIVI
YQYMDDLYVGSDLEIGKHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKILKTGKYAKMRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, N37D, R41K, R57K, H69K, L89M  
>G29-AFMC32| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Lall, M Profile of primary resistance in HIV-1-infected treatment-naive individuals from western India. ARHR, 2008