<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
G57 G57-AFMC29 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I15V, L19IT, E35D, M36L, R41K, L63P, H69K, A71V, I72V, I93L  
>G57-AFMC29| codons 1-99
PQITLWQRPLVPIKVGGQTKEALLDTGADDTVLEDLNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKVVGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39D, V60I, D121Y, K122E, I135V, S162H, K173A, D177E, I178M, V179I, T200A, E204K, Q207E, R211M, V245Q, A272P, K281R, T286A, E291D, V292I, I293IV, E297EA, P313S, V317VA, D324DE, G333DE, Q334QE, R356K, G359T, T377M, K390R, A400T  
>G57-AFMC29| codons 1-401
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRAQNPEMII
YQYMDDLYVGSDLEIGQHRAKIEKLREHLLMWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTDIVPLTAEAE
LELAENREILKESVHGAYYDPSKELIAEIQKQEEGQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETW

References
Author Title Citation
Lall, M Profile of primary resistance in HIV-1-infected treatment-naive individuals from western India. ARHR, 2008